Recombinant Human Sperm surface protein Sp17 (SPA17), partial

Code CSB-EP614892HU1
MSDS
Size US$212
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP121244h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPA17.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP121244h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPA17.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SPA17
Uniprot No.
Research Area
Cancer
Alternative Names
Band 34; Cancer/testis antigen 22; CT22; SP17 1; Sp17-1; SP17_HUMAN; SPA17; Sperm autoantigenic protein 17; Sperm protein 17; Sperm surface protein Sp17
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-146aa
Target Protein Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
43.8kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates.
Gene References into Functions
  1. Sp17 and ASP cancer/testis antigens were found in ciliated cells of four ciliated hepatic foregut cysts (CHFCs). Further characterization of Sp17 and ASP in patients with CHFCs may provide significant clues for understanding the molecular mechanisms underlying their predisposition to develop squamous cell carcinomas. PMID: 25600306
  2. dendritic cells from human umbilical cord blood modulated for SP17 expression induced antigen-specific anti-tumor immunity against SP17(+) non-small cell lung cancer. PMID: 26300426
  3. SP17/AKAP4/PTTG1 are expressed in both human NSCLC cell lines and primary tumors and can elicit an immunogenic response in lung cancer patients. PMID: 25739119
  4. NY-ESO-1 and SP17 was not significantly associated with a specific histotype, but high-level GAGE expression was more frequent in squamous cell carcinoma. GAGE expression was demonstrated to be significantly higher in stage II-IIIa than stage I NSCLC. PMID: 24103781
  5. Sp17 is highly expressed in hepatocellular carcinoma cells PMID: 23923079
  6. SP17 was expressed in many cancer types with an overall frequency of 12%. SP17 was most frequently expressed in a different set of cancer types than MAGE-A and GAGE antigens and rarely overlapped with these proteins. PMID: 23137323
  7. Sperm protein 17 is highly expressed in endometrial and cervical cancers. PMID: 20712874
  8. Data show that cisplatin induced decrease in Sp17 levels was due to transcriptional inhibition and cisplatin-resistant cell lines did not show this decrease in Sp17 levels in response to cisplatin treatment. PMID: 19685492
  9. Sp17 has different expression patterns in cancer cell lines as compared to normal non-testes tissues and a potential pathogenic role in diseased cells PMID: 12213290
  10. focuses on the characterization of the genomic organization of an intron-containing gene and establishes a new transcription model PMID: 12393185
  11. expression of Sp17, a thought to be gamete-specific protein, in the synoviocytes of 8/8 female rheumatoid arthritis patients PMID: 12739786
  12. identification of a nonapeptide sequence within the Sp17 protein that is predicted to have a high binding affinity for HLA-A1 molecules PMID: 14566839
  13. Sp17 is expressed in the cell nucleus of ovarian neoplasms PMID: 14712480
  14. Sp17 gene expression in myeloma cells is regulated by promoter methylation PMID: 15381930
  15. Overexpression of sperm protein 17 is associated with esophageal cancer PMID: 17230514
  16. in vitro cultured, monoclonal, cytotoxic T lymphocytes (derived either from advanced OC patients or from healthy donors), specific for sperm protein 17, can eradicate human metastatic OC cells. PMID: 18779750
  17. Results suggest a possible role of Sp17 in regulating sperm maturation, capacitation, acrosomal reaction and interactions with the oocyte zona pellucida during the fertilization process. PMID: 19604394
  18. HSp17 plays a role in metastatic disease and resistance of epithelial ovarian carcinoma to chemotherapy PMID: 19744347

Show More

Hide All

Subcellular Location
Membrane; Peripheral membrane protein.
Tissue Specificity
Testis and sperm specific.
Database Links

HGNC: 11210

OMIM: 608621

KEGG: hsa:53340

STRING: 9606.ENSP00000227135

UniGene: Hs.286233

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*